Antibodies, Unconjugated

182 Results Found

Mouse IgG2b (Myeloma) Protein

Liquid with 1.0 mg of protein in 0.02 M Tris, 0.15 M sodium chloride, pH 8.1. No preservative has been added

Rabbit Peroxidase Anti-Peroxidase (Pap)

Product is the lyophilized powder of rabbit peroxidase anti-peroxidase complexes (PAP) and buffer salts

Antigen Affinity Gel Rabbit IgG (Whole Molecule)

Product is rabbit IgG (whole molecule) covalently coupled to Sepharose-4B, and packed in a polystyrene chromatography column.

Rabbit Affinity Purified Antibody To Bovine Albumin

Product is rabbit affinity purified antibody to bovine albumin and buffer salts.

Goat Affinity Purified Antibody To Cat IgG (Whole Molecule)

Product is goat affinity purified antibody to cat IgG (whole molecule) and buffer salts.

Goat Affinity Purified F(Ab')2 Fragment To Human IgG Fc

Product is goat affinity purified F(ab')2 fragments to human IgG Fc and buffer salts. The affinity purified F(ab')2 fragment is prepared from the specific goat IgG fraction by limited digestion with pepsin and solid phase absorption. The resulting affinity purified F(ab')2 fragment is dialyzed into 0.02M sodium phosphate, 0.14M sodium chloride, pH 7.3, adjusted to standard titer, filtered through a 0.22 µm filter, and vialed.

Goat Affinity Purified F(Ab')2 Fragment To Human IgM (5Fc Mu)

: Product is goat affinity purified F(ab')2 fragments to human IgM (5Fc µ) and buffer salts. The affinity purified F(ab')2 fragment is prepared from the specific goat IgG fraction by limited digestion with pepsin and solid phase absorption. The resulting affinity purified F(ab')2 fragment is dialyzed into 0.02M sodium phosphate, 0.14M sodium chloride, pH 7.3, adjusted to standard titer, filtered through a 0.22 µm filter, and vialed.

Monoclonal Mouse Anti-Chondroitin-4-Sulfate Antibody

Reacts with both mouse (fetal and adult) and human (fetal and adult) chondroitinase ABC digested cartilage proteoglycans. Chondroitin-4 sulfate disaccharides successfully inhibit the binding of monoclonal antibody to proteoglycans.

Monoclonal Mouse Anti-Chondroitin-6-Sulfate Antibody

Reacts with a wide range of cartilage proteoglycans after either chondroitinase (ABC or AC) or testicular hyaluronidase digestion.

Monoclonal Anti-Alpha-Smooth Muscle Actin (Mouse Ascites Fluid), Clone 1A4

Anti-α-Smooth Muscle Actin
Clone: 1A4
Isotype: mouse IgG2a ascites
Conc/Titer: 1:400
Applications: Indirect Immunofluorescence.
The original immunogen was the NH2 terminal synthetic decapeptide of α smooth muscle actin coupled to KLH. It is specific for the single isoform α smooth muscle actin. In the original publication describing this antibody it was named anti-alpha-sm-1.

Mouse Anti-Actin Mab Clone B4

The monoclonal actin (clone B4) antibody is a mouse IgG1, kappa light chain antibody. Chicken gizzard was used as the immunogen. Immunoblots demonstrate specificity directed towards the smooth muscle gamma-enteric isoform of actin. This antibody can be used to detect the other smooth muscle actin (alpha-skeletal, alpha-cardiac and alpha-vascular) found in vertebrates.

ARID1A Monoclonal Antibody (M02), Clone 3H14

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Rabbit Anti-Bovine Serum Albumin

Product is the lyophilized powder of anti-bovine serum albumin from rabbit IgG fraction with buffer salts.

Rabbit Antiserum To Bovine IgG (Whole Molecule)

Product is the lyophilized powder of rabbit antiserum to bovine IgG (whole molecule) and buffer salts. The antiserum is prepared by hyperimmunizing rabbits with highly purified bovine IgG; antiserum is delipidated and made specific by solid-phase absorption.

Rabbit IgG Fraction To Bovine IgG (Whole Molecule)

Product is the lyophilized powder of rabbit IgG fraction to bovine IgG (whole molecule) and buffer salts

Goat Antiserum To Bovine Serum (Forensic)

Product is the lyophilized powder of goat antiserum to bovine serum and buffer salts.

0865850-anti-thyroxine-serum-rabbit-anti-t4.jpg

Rabbit Anti-Thyroxine BSA Serum

Product is lyophilized. Reconstitute with 1.0 ml of distilled water and let stand for 30 minutes at room temperature.

Rabbit Antiserum To Bovine Transferrin

Product is the lyophilized powder of rabbit antiserum to bovine transferrin and buffer salts.

Goat Antiserum To Cat Serum (Forensic)

Product is the lyophilized powder of goat antiserum to cat serum and buffer salts