Antibodies, Mouse

40 Results Found

Monoclonal Mouse Anti-Chondroitin-4-Sulfate Antibody

Reacts with both mouse (fetal and adult) and human (fetal and adult) chondroitinase ABC digested cartilage proteoglycans. Chondroitin-4 sulfate disaccharides successfully inhibit the binding of monoclonal antibody to proteoglycans.

Monoclonal Mouse Anti-Chondroitin-6-Sulfate Antibody

Reacts with a wide range of cartilage proteoglycans after either chondroitinase (ABC or AC) or testicular hyaluronidase digestion.

Monoclonal Anti-Alpha-Smooth Muscle Actin (Mouse Ascites Fluid), Clone 1A4

Anti-α-Smooth Muscle Actin
Clone: 1A4
Isotype: mouse IgG2a ascites
Conc/Titer: 1:400
Applications: Indirect Immunofluorescence.
The original immunogen was the NH2 terminal synthetic decapeptide of α smooth muscle actin coupled to KLH. It is specific for the single isoform α smooth muscle actin. In the original publication describing this antibody it was named anti-alpha-sm-1.

Mouse Anti-Actin Mab Clone B4

The monoclonal actin (clone B4) antibody is a mouse IgG1, kappa light chain antibody. Chicken gizzard was used as the immunogen. Immunoblots demonstrate specificity directed towards the smooth muscle gamma-enteric isoform of actin. This antibody can be used to detect the other smooth muscle actin (alpha-skeletal, alpha-cardiac and alpha-vascular) found in vertebrates.

ARID1A Monoclonal Antibody (M02), Clone 3H14

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Anti-Desmin Ii Monoclonal From Mouse

Anti-Human
Clone:
D9
Isotype: mouse IgG1
Conc/Titer: 1:5-1:20
Applications: Immunoblotting; Immunostaining of cell suspensions, acetone-fixed frozen tissue sections, and formalin-fixed, paraffin-embedded tissue sections.
The antibody was prepared from human leyomyoma. The antibody is specific to 53 kDa desmin protein in immunoblotting and gives the same cell staining pattern as cat. no. 10570, polyclonal desmin antibody. No cross-reactivity with any other intermediate filament protein. It does cross-react with desmin of most mammals including mouse, rabbit and rat. It is supplied as clarified cell culture supernatant with 0.09% sodium azide.
Ref.: Muyen, G.N.P. van, et al., Lab. Invest., 57: 359-369 (1987).

Mouse Anti-Desmoplakin 1 & 2, Monoclonal

The anti-desmoplakin 1 & 2 is a mouse IgG1 immunoglobulin. It is purified by affinity chromatography. The antigen is bovine desmoplakins 1 & 2.

Monoclonal Anti-Epithelial Keratin - AE1/AE3 Mixture

Anti-Human
Clone:
AE1/AE3 mixture
Isotype: purified Ig fraction from ascites
Conc/Titer: 1:100-1:200
Applications: Immunohistochemistry; Immunoblotting
This is a specially formulated mix that is broadly reactive with most acidic (Type 1) keratins and all known basic (Type 2) keratins. It exhibits cross-reactivity to human, rabbit, mouse, rat, bovine, and chick. This mix can be used for the positive identification of normal and abnormal epithelial cells and tissues. It works well on unfixed frozen sections and alcohol or formalin fixed, paraffin sections.

Monoclonal Mouse Anti-Epithelial Keratin - AE5

Monoclonal Mouse Anti-Epithelial Keratin antibody is specific for the basic 64K keratin which, together with the acidic 55K keratin, has been designated as a marker for "corneal-type differentiation".

Monoclonal Mouse Anti-Epithelial Keratin (AE8)

Anti-Human
Clone:
AE8
Isotype: purified Ig fraction from ascites
Conc/Titer: 1:50-1:500
Form: Liquid, purified IgG fraction from ascites fluid.
Applications: Immunoblotting; Indirect Immunofluorescence; Tissue sections
This antibody reacts strongly with the acidic 51 kDa (number 13) keratin which is expressed mainly in the suprabasal cells of esophageal, ventral tongue, buccal mucosal, exocervical and many other internal, non-keratinized stratified squamous epithelia. It can be used as markers for "esophageal-type differentiation."

H00051024-M01-3-36-1-L.jpg

FIS1 Monoclonal Antibody (M01), Clone 1G9

Mouse monoclonal antibody raised against a full length recombinant FIS1.

Anti-α-Fodrin (Nonerythroid Spectrin) Monoclonal (Clone AA6)

Anti-Human
Clone:
AA6
Isotype: affinity purified mouse IgG1
Conc/Titer: 0.1 μg/ml
Applications: Immunohistochemistry, Western Blotting, and additional Immunoassays.
The original immunogen was chicken blood cell membranes which were purified by hypotonic lysis and mechanical enucleation. The AA6 antibody is specific to the 240 kDa alpha-fodrin molecule of all mammalian non-erythroid cells and to chicken alpha-spectrin.

Mouse, Anti-Beta-Galactosidase, Purified Monoclonal Antibody

Anti-Galactosidase, purified monoclonal antibody [subclass IgG2a(k)] was purified from ascites of a mouse hybridoma and recognizes E. coli β-galactosidase. Recognizes the native and denatured enzyme near the C-terminal end.

Mouse, Anti-GFP, Monoclonal Antibody, With Bsa

Anti-GFP, Clone 3E6, is a mouse IgG2a monoclonal antibody (mAb) that recognizes the native form of the Green Fluorescent Protein (GFP), GFP variants and GFP-fusion proteins.

Purified Mouse Monoclonal Antibody (HIV.Ot 39B) To Human Immunodeficiency Virus

The product is 100 µg of purified murine monoclonal antibody (IgG1) to HIV-1 p24 (214-226) in lyophilization medium, consisting of 10 mM Tris-HCl, pH 7.4, with 15% sucrose.

Mouse Anti-Human IgE (Fc Region) Monoclonal

Mouse Anti-Human IgE (Fc region) Monoclonal, is supplied in 10 mM phosphate buffered saline, pH 7.4

Monoclonal Anti-Human IgG Fc Fragment (Clone HP6017)

Liquid, Monoclonal Anti-Human IgG Fc Fragment (Clone HP 6017) in 10 mM phosphate buffered saline, pH 7.4

Monoclonal Mouse Anti-Human IgG (Gamma Chain) (Clone: GG-5)

Anti-HumanClone: GG-5Isotype: mouse IgG1 kappaConc/Titer: 1:20Applications: PAP; immunohistochemistry; paraffin-embedded and frozen sectionsImmunohistology GradeThis antibody reacts to

Mouse Anti-Human IgM Monoclonal (Clone: HP6083)

Monoclonal anti-human IgM is conjugated with amino-hexanoyl-biotin N-hydroxysuccininimide under optimum conditions and is free of unconjugated biotin.

Monoclonal Anti-Human B-Lymphocyte LN-3

LN-3 is a murine monoclonal antibody (IgG2b) reactive with a nonpolymorphic HLA-DR (Ia-like) antigen. The antigens show the typical 29-33 K dalton molecular weight of Ia. The HLA-DR antigen is present on germinal center and mantle zone B cells, monocytes and macrophages and interdigitating histiocytes. T cells are generally negative although activated T cells may express HLA-DR.