Antibodies

320 Results Found

ARID1A Monoclonal Antibody (M02), Clone 3H14

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Rabbit Anti-Bovine Serum Albumin

Product is the lyophilized powder of anti-bovine serum albumin from rabbit IgG fraction with buffer salts.

Peroxidase-Conjugated Rabbit IgG Fraction To Bovine Albumin

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated rabbit IgG fraction to bovine albumin and buffer salts.

Rabbit Antiserum To Bovine IgG (Whole Molecule)

Product is the lyophilized powder of rabbit antiserum to bovine IgG (whole molecule) and buffer salts. The antiserum is prepared by hyperimmunizing rabbits with highly purified bovine IgG; antiserum is delipidated and made specific by solid-phase absorption.

Rabbit IgG Fraction To Bovine IgG (Whole Molecule)

Product is the lyophilized powder of rabbit IgG fraction to bovine IgG (whole molecule) and buffer salts

Goat Antiserum To Bovine Serum (Forensic)

Product is the lyophilized powder of goat antiserum to bovine serum and buffer salts.

0865850-anti-thyroxine-serum-rabbit-anti-t4.jpg

Rabbit Anti-Thyroxine BSA Serum

Product is lyophilized. Reconstitute with 1.0 ml of distilled water and let stand for 30 minutes at room temperature.

Rabbit Antiserum To Bovine Transferrin

Product is the lyophilized powder of rabbit antiserum to bovine transferrin and buffer salts.

Fluorescein-Conjugated Goat Affinity Purified Antibody To Cat IgG (Whole Molecule)

Product is fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat affinity purified antibody to cat IgG (whole molecule) and buffer salts.

Fluorescein-Conjugated Goat IgG Fraction To Cat IgG (Whole Molecule)

Product is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat IgG fraction to cat IgG (whole molecule) and buffer salts

Peroxidase-Conjugated Goat IgG Fraction To Cat IgG (Whole Molecule)

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated goat IgG fraction to cat IgG (whole molecule) and buffer salts.

Goat Antiserum To Cat Serum (Forensic)

Product is the lyophilized powder of goat antiserum to cat serum and buffer salts

Rabbit Antiserum To Chicken Serum Albumin

Product is the lyophilized powder of rabbit antiserum to chicken serum albumin and buffer salts.

Goat IgG Fraction To Chicken Egg Albumin

Product is the lyophilized powder of goat IgG fraction to chicken egg albumin and buffer salts.

Rabbit IgG Fraction To Chicken Red Blood Cells

Product is the lyophilized powder of rabbit IgG fraction to chicken red blood cells and buffer salts.

Goat Antiserum To Chicken Serum (Forensic)

Product is the lyophilized powder of goat antiserum to chicken serum and buffer salts.

Goat Antiserum To Deer Serum (Forensic)

Product is the lyophilized powder of goat antiserum to deer serum and buffer salts

Anti-Desmin Ii Monoclonal From Mouse

Anti-Human
Clone:
D9
Isotype: mouse IgG1
Conc/Titer: 1:5-1:20
Applications: Immunoblotting; Immunostaining of cell suspensions, acetone-fixed frozen tissue sections, and formalin-fixed, paraffin-embedded tissue sections.
The antibody was prepared from human leyomyoma. The antibody is specific to 53 kDa desmin protein in immunoblotting and gives the same cell staining pattern as cat. no. 10570, polyclonal desmin antibody. No cross-reactivity with any other intermediate filament protein. It does cross-react with desmin of most mammals including mouse, rabbit and rat. It is supplied as clarified cell culture supernatant with 0.09% sodium azide.
Ref.: Muyen, G.N.P. van, et al., Lab. Invest., 57: 359-369 (1987).

Mouse Anti-Desmoplakin 1 & 2, Monoclonal

The anti-desmoplakin 1 & 2 is a mouse IgG1 immunoglobulin. It is purified by affinity chromatography. The antigen is bovine desmoplakins 1 & 2.